PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538955.1_FGP018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 298aa    MW: 32828.4 Da    PI: 10.2768
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538955.1_FGP018genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.2e-32144200158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  KN538955.1_FGP018 144 EEPIFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 200
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-37142203IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.238143203IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-27145200IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-24146168IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860148168IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.7E-24177200IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSAPFIRQAA AHRPPLIREK EKEADKYTKK NGAWTKVRPS HNANAFATNG RSSSPCYTQL  60
YYQMKQLGHK MYDQDSPSSD SGQSHQEESA MNDSSPNERH TSTQSADAYY GGVLTGYSSH  120
AIVHPQQNGT ANSRVPLPVE PAAEEPIFVN AKQYHAILRR RQIRAKLEAQ NKLVKGRKPY  180
LHESRHRHAM KRARGSGGRF LNTKQLEEQK QQQEEEAASG GASSGNRTCL QNGTGSAPSA  240
SAPSEIASVS TSREFLGNHE QSHFPSAGFL PTMSFRAQNG GDGKLVANAI HQRVSMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-23144205263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184193RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880330.0AB288033.1 Oryza sativa Japonica Group OsHAP2G mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1016840.0AK101684.1 Oryza sativa Japonica Group cDNA clone:J033058N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.11e-147PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646560.11e-147PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646561.11e-147PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646562.11e-147PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ9LNP62e-43NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A0E0LN511e-152A0A0E0LN51_ORYPU; Uncharacterized protein
STRINGORGLA07G0166900.11e-147(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.46e-33nuclear factor Y, subunit A8